PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10026733m
Common NameCICLE_v10026733mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 139aa    MW: 15658.3 Da    PI: 9.9446
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10026733mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.15.8e-3143101159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +dDg++WrKYG+K+vk+s++pr+YY+C++ gC+vkk+ver++ed ++v++tYeg+Hnhe
  Ciclev10026733m  43 MDDGFKWRKYGKKSVKNSPNPRNYYKCSTGGCQVKKRVERDREDSSYVITTYEGTHNHE 101
                      69********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.7E-3330103IPR003657WRKY domain
SuperFamilySSF1182905.23E-2835103IPR003657WRKY domain
PROSITE profilePS5081130.91738103IPR003657WRKY domain
SMARTSM007748.6E-3443102IPR003657WRKY domain
PfamPF031061.6E-2444101IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGGSSSGATS EKNNIKSKNG IKKMKMEVGQ RFAFRTKSEL EVMDDGFKWR KYGKKSVKNS  60
PNPRNYYKCS TGGCQVKKRV ERDREDSSYV ITTYEGTHNH ESPCVVYDYY NHHQQQMPQN  120
GWTLQPNSSS SPPSSSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2633103777Probable WRKY transcription factor 4
2lex_A7e-2633103777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006427979.11e-100hypothetical protein CICLE_v10026733mg
RefseqXP_006464492.11e-99PREDICTED: probable WRKY transcription factor 50
SwissprotQ93WU96e-41WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLV4UP261e-100V4UP26_9R
STRINGPOPTR_0007s06720.18e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57112747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-40WRKY DNA-binding protein 51